Skip to product information
1 of 1

Gene Bio Systems

Recombinant Glycine max Cell division cycle protein 48 homolog(CDC48),partial

Recombinant Glycine max Cell division cycle protein 48 homolog(CDC48),partial

SKU:CSB-EP346583GGV

Regular price $1,492.40 CAD
Regular price Sale price $1,492.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: P54774

Gene Names: CDC48

Organism: Glycine max (Soybean) (Glycine hispida)

AA Sequence: DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS

Expression Region: 653-807aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.5 kDa

Alternative Name(s): Valosin-containing protein homolog Short name: VCP

Relevance: Probably functions in cell division and growth processes.

Reference: "Identification of cDNA clones encoding valosin-containing protein and other plant plasma membrane-associated proteins by a general immunoscreening strategy."Shi J., Dixon R.A., Gonzales R.A., Kjellbom P., Bhattacharyya M.K.Proc. Natl. Acad. Sci. U.S.A. 92:4457-4461(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details