Gene Bio Systems
Recombinant Gloeobacter violaceus Photosystem II reaction center protein H(psbH)
Recombinant Gloeobacter violaceus Photosystem II reaction center protein H(psbH)
SKU:CSB-CF752392GCI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gloeobacter violaceus (strain PCC 7421)
Uniprot NO.:Q7NCH7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20ā, for extended storage, conserve at -20ā or -80ā.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā for up to one week.
AA Sequence:MARRTWLGDRLKPLNSEIGKASPGWGTTPIMGALIALFGVFLIIILQIANNSLLLEGVNE GVPQSPAGQGYGYYPQSR
Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H
Gene Names:Name:psbH Ordered Locus Names:gsr3002
Expression Region:1-78
Sequence Info:full length protein
