Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gloeobacter violaceus Photosystem I reaction center subunit III(psaF)

Recombinant Gloeobacter violaceus Photosystem I reaction center subunit III(psaF)

SKU:CSB-CF759497GCI

Regular price $2,091.60 CAD
Regular price Sale price $2,091.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gloeobacter violaceus (strain PCC 7421)

Uniprot NO.:Q7NH05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QTQVKDPLKLCKDVPAYQELKTQRLEAAQKAQADGKPVTFNEAGTKQKFERYDTAYCGQD GYPHLITSGQLDRAGDFLIPSVLFLWIAGALGWAGRLYLAESKGPEDEIIIDLPKAIKCL LLGLIWPVQAIPELISGKIRVPEDRVTISPR

Protein Names:Recommended name: Photosystem I reaction center subunit III Alternative name(s): PSI-F

Gene Names:Name:psaF Ordered Locus Names:glr2732

Expression Region:31-181

Sequence Info:full length protein

View full details