Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)
Uniprot NO.:Q4HXT6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPFTASITAYTNIFFSDICKIILAIILPPVGVFLERGCGADFFINILLTILGYIPGIIHA LYIILKY
Protein Names:Recommended name: Plasma membrane proteolipid 3
Gene Names:Name:PMP3 ORF Names:FG10222
Expression Region:1-67
Sequence Info:full length protein