Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gibberella zeae Peptidyl-prolyl cis-trans isomerase B(CPR2)

Recombinant Gibberella zeae Peptidyl-prolyl cis-trans isomerase B(CPR2)

SKU:CSB-CF676850GGB

Regular price $2,135.00 CAD
Regular price Sale price $2,135.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)

Uniprot NO.:Q4I5R9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AKGPKITHKVYFDITQGDQPLGRVVMGLYGKTVPETTENFRALATGEKGFGYEGSAFHRV IKNFMIQGGDFTKGDGTGGKSIYGDRFKDENFKLKHTKKGLLSMANAGRDTNGSQFFITT VVTSWLDGKHVVFGEVLEGYEIIEKIENSKTGAADRPVEAVKIAKSGELDVPPEGIHVEL

Protein Names:Recommended name: Peptidyl-prolyl cis-trans isomerase B Short name= PPIase B EC= 5.2.1.8 Alternative name(s): Rotamase B

Gene Names:Name:CPR2 ORF Names:FG07439

Expression Region:28-207

Sequence Info:full length protein

View full details