Gene Bio Systems
Recombinant Geobacter metallireducens Protein CrcB homolog(crcB)
Recombinant Geobacter metallireducens Protein CrcB homolog(crcB)
SKU:CSB-CF663874GBJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)
Uniprot NO.:Q39R93
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLTIVAIALFGALGCLARYLLAGWVYAFVGRGFPYGTLTVNVVGAFLIGLIMEFSLRTTL IPQELRIGLTIGFLGGLTTFSTFSYETFRLLEDGEFITAAVNVLASVLVCLACTWLGIMT ARHL
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:Gmet_3016
Expression Region:1-124
Sequence Info:full length protein
