Skip to product information
1 of 1

Gene Bio Systems

Recombinant Geobacter metallireducens Protein CrcB homolog(crcB)

Recombinant Geobacter metallireducens Protein CrcB homolog(crcB)

SKU:CSB-CF663874GBJ

Regular price $2,052.40 CAD
Regular price Sale price $2,052.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210)

Uniprot NO.:Q39R93

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLTIVAIALFGALGCLARYLLAGWVYAFVGRGFPYGTLTVNVVGAFLIGLIMEFSLRTTL IPQELRIGLTIGFLGGLTTFSTFSYETFRLLEDGEFITAAVNVLASVLVCLACTWLGIMT ARHL

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:Gmet_3016

Expression Region:1-124

Sequence Info:full length protein

View full details