
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacillus stearothermophilus (Bacillus stearothermophilus)
Uniprot NO.:P94456
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSFRNIHYFLLLIVIAVPLGKYLYVAFFEKGKIDRFFSPIEAVIYRLSGIRSLEEMTWKS YCTALLIVNAALLGISYGLLRIQHYLPLNGAKVENMEPTLTFNTVVSFMTNTNLQ
Protein Names:Recommended name: Potassium-transporting ATPase A chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] A chain Potassium-binding and translocating subunit A Potassium-translocating ATPase A chain
Gene Names:Name:kdpA
Expression Region:1-115
Sequence Info:full length protein