Gene Bio Systems
Recombinant Geobacillus stearothermophilus Gellan lyase
Recombinant Geobacillus stearothermophilus Gellan lyase
SKU:CSB-EP308328GFM
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P85513
Gene Names: N/A
Organism: Geobacillus stearothermophilus (Bacillus stearothermophilus)
AA Sequence: LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR
Expression Region: 1-204aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 24.5 kDa
Alternative Name(s):
Relevance: Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.
Reference: Physicochemical characteristics of a thermostable gellan lyase from Geobacillus stearothermophilus 98.Derekova A., Atanassova M., Christova P., Tchorbanov B., Shosheva A., Mandeva R., Rodriguez-Alonso P., Garabal J.I., Kambourova M.Z. Naturforsch. C Biosci. 65:231-238(2010)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
