Gene Bio Systems
Recombinant Geobacillus kaustophilus UPF0756 membrane protein GK2737(GK2737)
Recombinant Geobacillus kaustophilus UPF0756 membrane protein GK2737(GK2737)
SKU:CSB-CF689370GAAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Geobacillus kaustophilus (strain HTA426)
Uniprot NO.:Q5KWB4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNEPVLFLLLLLALGFLAKNKSLIVAIVVLLAIKLVGLDQKVLPIIQSKGINWGVTVITI AVLAPIASGEIGFRQLVGSLQSLSAWVALASGIFVALIAKNGVTLLANDPHMTAALAFGT ILAVSLFHGVAVGPLIGAGIAYTVIKMVEYF
Protein Names:Recommended name: UPF0756 membrane protein GK2737
Gene Names:Ordered Locus Names:GK2737
Expression Region:1-151
Sequence Info:full length protein
