Recombinant Geobacillus kaustophilus  UPF0295 protein GK0479(GK0479)

Recombinant Geobacillus kaustophilus UPF0295 protein GK0479(GK0479)

CSB-CF711512GAAA
Regular price
$1,458.00 CAD
Sale price
$1,458.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacillus kaustophilus (strain HTA426)

Uniprot NO.:Q5L2R6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIKYSSKINKIRTFALSLIFIGVIVMYLGLFFRTSPVIMTLFMLFGMLFLVASGIVYFW IGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKKRKS

Protein Names:Recommended name: UPF0295 protein GK0479

Gene Names:Ordered Locus Names:GK0479

Expression Region:1-117

Sequence Info:full length protein

Your list is ready to share