Recombinant Geobacillus kaustophilus  Protein CrcB homolog 2(crcB2)

Recombinant Geobacillus kaustophilus Protein CrcB homolog 2(crcB2)

CSB-CF708524GAAA
Regular price
$1,471.00 CAD
Sale price
$1,471.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacillus kaustophilus (strain HTA426)

Uniprot NO.:Q5KWE8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVYLAVGIAGMIGALVRYGLGLVVPAAAVGGFPLGTLFINWTGSFLLSWFTVMFTRRPAW PPWLKTAVTTGFVGSYTTFSTLSVECVELMEQGRFGMAAVYIAASLFGGLLASWAGYAAA QPERKEGIG

Protein Names:Recommended name: Protein CrcB homolog 2

Gene Names:Name:crcB2 Ordered Locus Names:GK2703

Expression Region:1-129

Sequence Info:full length protein

Your list is ready to share