Gene Bio Systems
Recombinant Gallid herpesvirus 2 Uncharacterized gene 11 protein(MDV011)
Recombinant Gallid herpesvirus 2 Uncharacterized gene 11 protein(MDV011)
SKU:CSB-CF887633GAN
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)
Uniprot NO.:Q9E6R4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSERALTLAPGKVSTADIYEADFSFRREFVRQILQREFILFEISMYIIFIVTFCYKIIL FLFRIIPKDLDHRQRNRGRKMSASA
Protein Names:Recommended name: Uncharacterized gene 11 protein
Gene Names:Name:MDV011
Expression Region:1-85
Sequence Info:full length protein
