Skip to product information
1 of 1

Gene Bio Systems

Recombinant Gadus morhua subsp. callarias Parvalbumin beta

Recombinant Gadus morhua subsp. callarias Parvalbumin beta

SKU:CSB-EP365766GAA

Regular price $1,332.50 CAD
Regular price Sale price $1,332.50 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P02622

Gene Names: N/A

Organism: Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias)

AA Sequence: AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG

Expression Region: 1-113aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 16.1 kDa

Alternative Name(s):

Relevance: In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.

Reference: The primary structure of allergen M from cod.Elsayed S., Bennich H.Scand. J. Immunol. 4:203-208(1975)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details