
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P02622
Gene Names: N/A
Organism: Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias)
AA Sequence: AFKGILSNADIKAAEAACFKEGSFDEDGFYAKVGLDAFSADELKKLFKIADEDKEGFIEEDELKLFLIAFAADLRALTDAETKAFLKAGDSDGDGKIGVDEFGALVDKWGAKG
Expression Region: 1-113aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 16.1 kDa
Alternative Name(s):
Relevance: In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.
Reference: The primary structure of allergen M from cod.Elsayed S., Bennich H.Scand. J. Immunol. 4:203-208(1975)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.