Recombinant Gadus morhua Parvalbumin beta

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Gadus morhua Parvalbumin beta

CSB-EP852688GER
Regular price
$1,332.50 CAD
Sale price
$1,332.50 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: Q90YK9

Gene Names: N/A

Organism: Gadus morhua (Atlantic cod)

AA Sequence: AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA

Expression Region: 2-109aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.4 kDa

Alternative Name(s): Allergen: Gad m 1

Relevance: In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions

Reference: "The major allergen (parvalbumin) of codfish is encoded by at least two isotypic genes: cDNA cloning, expression and antibody binding of the recombinant allergens."Van Do T., Hordvik I., Endresen C., Elsayed S.Mol. Immunol. 39:595-602(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share