Skip to product information
1 of 1

Gene Bio Systems

Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic(FCPE)

Recombinant Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic(FCPE)

SKU:CSB-CF669219PAAY

Regular price $1,887.50 CAD
Regular price Sale price $1,887.50 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Phaeodactylum tricornutum

Uniprot NO.:Q41093

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AFENELGAQPPLGFFDPLGLVADGDQEKFDRLRYVEIKHGRISMLAVAGYLVQENGIRLP GDIDYSGTSFESIPNGFAALTTISGAGIAQIVAFIGFLELAVMKDITGGEFVGDFRNDFI DFGWDSFDEETKMQKRAIELNQGRAAQMGILALMVHEQLGVSLIPN

Protein Names:Recommended name: Fucoxanthin-chlorophyll a-c binding protein E, chloroplastic

Gene Names:Name:FCPE Synonyms:FPC3

Expression Region:32-197

Sequence Info:full length protein

View full details