Gene Bio Systems
Recombinant Francisella tularensis subsp. tularensis Protein CrcB homolog(crcB)
Recombinant Francisella tularensis subsp. tularensis Protein CrcB homolog(crcB)
SKU:CSB-CF618962FAAD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Francisella tularensis subsp. tularensis (strain FSC 198)
Uniprot NO.:Q14JI2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLLLLLVGIGGGFGAMARFALTQATASISKQIPLGILLCNIIGSLIIGMMAAFLIETKL FNEDVSTYVRFLLVTGFLGGFTTFSSFSLDILNLLQRGEIFIAIGYIMVSVLASLIAVIL GFYIVMGVYK
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:FTF0260
Expression Region:1-130
Sequence Info:full length protein
