Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Fowlpox virus (strain NVSL) (FPV)
Uniprot NO.:O72899
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKLFTGTYGVFLESNDSDFEDFINTIMTVLTGKKESKQLSWLTIFIIFVVCIVVFTFLY LKLMC
Protein Names:Recommended name: Protein I2 homolog Alternative name(s): Protein FPV089
Gene Names:Ordered Locus Names:FPV089 ORF Names:FPI2L
Expression Region:1-65
Sequence Info:full length protein