Skip to product information
1 of 1

Gene Bio Systems

Recombinant Fowl adenovirus A serotype 1 Uncharacterized protein ORF21(21)

Recombinant Fowl adenovirus A serotype 1 Uncharacterized protein ORF21(21)

SKU:CSB-CF731082FCL

Regular price $2,027.20 CAD
Regular price Sale price $2,027.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Fowl adenovirus A serotype 1 (strain CELO / Phelps) (FAdV-1) (Avian adenovirus gal1 (strain Phelps))

Uniprot NO.:Q64764

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCTGSTGSLIPSVSDSANSVRRGNLSLCSVLLSWLICAMCLWNDARESLVNVRIANYVFD FAVLWTLLARVLGPPGRPVLQQHHPVQLPVPTEPSVFVKLCNQRVRL

Protein Names:Recommended name: Uncharacterized protein ORF21

Gene Names:ORF Names:21

Expression Region:1-107

Sequence Info:full length protein

View full details