Skip to product information
1 of 1

Gene Bio Systems

Recombinant Feline enteric coronavirus Non-structural 7a protein (7a)

Recombinant Feline enteric coronavirus Non-structural 7a protein (7a)

SKU:CSB-CF333797FAI

Regular price $1,983.80 CAD
Regular price Sale price $1,983.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Feline enteric coronavirus (strain 79-1683) (FeCoV) (FECV)

Uniprot NO.:P33465

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LERLLLSHLLNLTTVSNVLGVPDSSLRVNCLQLLKPDCLDFNILHKVLAETRLLVVVLRV IFLVLLGFSCYTLLGALF

Protein Names:Recommended name: Non-structural 7a protein Short name= ns7a Alternative name(s): 11 kDa protein Accessory protein 7a

Gene Names:ORF Names:7a

Expression Region:24-101

Sequence Info:full length protein

View full details