Skip to product information
1 of 1

Gene Bio Systems

Recombinant Exopolysaccharide production repressor protein(exoX)

Recombinant Exopolysaccharide production repressor protein(exoX)

SKU:CSB-CF318589RKO

Regular price $1,996.40 CAD
Regular price Sale price $1,996.40 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. phaseoli

Uniprot NO.:P14801

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHQRCFGLRASLSIFKAFAVTLAASVFLQVVYFLSLLFMSFRPTRESDRSIHSGTRQADQ PQKRDRDKTEQSNVPKLDPRRKRRTP

Protein Names:Recommended name: Exopolysaccharide production repressor protein Alternative name(s): Polysaccharide inhibition protein

Gene Names:Name:exoX Synonyms:psi, psiA

Expression Region:1-86

Sequence Info:full length protein

View full details