Skip to product information
1 of 1

Gene Bio Systems

Recombinant Exiguobacterium sibiricum UPF0316 protein Exig_2248 (Exig_2248)

Recombinant Exiguobacterium sibiricum UPF0316 protein Exig_2248 (Exig_2248)

SKU:CSB-CF452115EPT

Regular price $2,121.00 CAD
Regular price Sale price $2,121.00 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Uniprot NO.:B1YKE7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGQILLILLLQLIYVPVLTLRTIMLVKGRTIIAGVLGTVETLIYIFALGIVFRDLTTVGM IVYALGFGLGILIGGFVERKLAIGYNMIQVHTQDFPAELIQVIRDNGFGVTHYQGQGRDG IRYRLDVLAARTRMKVLRNLVEEYEPKAFLVAFDSVDFKGGYMLKGLKRSQ

Protein Names:Recommended name: UPF0316 protein Exig_2248

Gene Names:Ordered Locus Names:Exig_2248

Expression Region:1-171

Sequence Info:full length protein

View full details