Gene Bio Systems
Recombinant Escherichia fergusonii UPF0208 membrane protein YfbV(yfbV)
Recombinant Escherichia fergusonii UPF0208 membrane protein YfbV(yfbV)
SKU:CSB-CF485026EOR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)
Uniprot NO.:B7LM37
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTPDDRSVNFFSLFRRGQHYSKTWPMEKRLAPVFVENRVIRMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPSILNWFYEVRGKLQDAGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Protein Names:Recommended name: UPF0208 membrane protein YfbV
Gene Names:Name:yfbV Ordered Locus Names:EFER_0874
Expression Region:1-151
Sequence Info:full length protein
