Gene Bio Systems
Recombinant Escherichia coli UPF0060 membrane protein YnfA(ynfA)
Recombinant Escherichia coli UPF0060 membrane protein YnfA(ynfA)
SKU:CSB-CF509264ENU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12 / MC4100 / BW2952)
Uniprot NO.:C4ZWZ4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT
Protein Names:Recommended name: UPF0060 membrane protein YnfA
Gene Names:Name:ynfA Ordered Locus Names:BWG_1396
Expression Region:1-108
Sequence Info:full length protein
