Recombinant Escherichia coli  Universal stress protein B(uspB)

Recombinant Escherichia coli Universal stress protein B(uspB)

CSB-CF543645ENT
Regular price
$1,452.00 CAD
Sale price
$1,452.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12 / DH10B)

Uniprot NO.:B1X7U9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH

Protein Names:Recommended name: Universal stress protein B

Gene Names:Name:uspB Ordered Locus Names:ECDH10B_3670

Expression Region:1-111

Sequence Info:full length protein

Your list is ready to share