Gene Bio Systems
Recombinant Escherichia coli Uncharacterized protein ygfX(ygfX)
Recombinant Escherichia coli Uncharacterized protein ygfX(ygfX)
SKU:CSB-CF676096ENV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12)
Uniprot NO.:Q46824
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRI NARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAE WRDLRRILLQQETQR
Protein Names:Recommended name: Uncharacterized protein ygfX
Gene Names:Name:ygfX Ordered Locus Names:b2896, JW2864
Expression Region:1-135
Sequence Info:full length protein
