Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Uncharacterized membrane protein YuaD(yuaD)

Recombinant Escherichia coli Uncharacterized membrane protein YuaD(yuaD)

SKU:CSB-CF888368ENV

Regular price $2,144.80 CAD
Regular price Sale price $2,144.80 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:Q9JMT6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRAYCPHYQFMLFWIASLCWFSLIVLWGTGFYSLLFYIISVLLIIILYTLYFIGENMFSK GKIKESDSTTTIISKNTSFVGDISSGEKIIIHGKINGNINTNNGVVFIDKGGVVNGRVLC EKMILNGELYGECCCSTLDVYENGFLQGEVSYRFLEIRNGGCITGIVNKVTDEVQNNVSE LVKARES

Protein Names:Recommended name: Uncharacterized membrane protein YuaD

Gene Names:Name:yuaD Synonyms:ybcA Ordered Locus Names:ECOK12F013

Expression Region:1-187

Sequence Info:full length protein

View full details