Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Sulfoxide reductase heme-binding subunit YedZ(yedZ)

Recombinant Escherichia coli Sulfoxide reductase heme-binding subunit YedZ(yedZ)

SKU:CSB-CF541409ENX

Regular price $2,181.20 CAD
Regular price Sale price $2,181.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain SMS-3-5 / SECEC)

Uniprot NO.:B1LQN7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLTAKQVTWLKVSLHLAGLLPFLWLVWAINHGGLGADPVKDIQHFTGRTALKFLLATLL ITPLARYVKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTL GIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPLIYA GLAVLLLALRYKKLRSLFNRLRKQVHNKLSV

Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ

Gene Names:Name:yedZ Ordered Locus Names:EcSMS35_1213

Expression Region:1-211

Sequence Info:full length protein

View full details