Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Protein SrnB(srnB)

Recombinant Escherichia coli Protein SrnB(srnB)

SKU:CSB-CF320304ENV

Regular price $1,758.75 CAD
Regular price Sale price $1,758.75 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P13970

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKYLNTTDCSLFLAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQV TLAYEARK

Protein Names:Recommended name: Protein SrnB

Gene Names:Name:srnB Ordered Locus Names:ECOK12F004/ECOK12F005

Expression Region:1-68

Sequence Info:full length protein

View full details