Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL)

Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF473798EOE

Regular price $2,070.60 CAD
Regular price Sale price $2,070.60 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7 (strain EC4115 / EHEC)

Uniprot NO.:B5YT10

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLTEIRDLLKEQNNRS

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:ECH74115_4613

Expression Region:1-136

Sequence Info:full length protein

View full details