Gene Bio Systems
Recombinant Escherichia coli O127:H6 Protein AaeX(aaeX)
Recombinant Escherichia coli O127:H6 Protein AaeX(aaeX)
SKU:CSB-CF485621EOB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Uniprot NO.:B7UJX4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV
Protein Names:Recommended name: Protein AaeX
Gene Names:Name:aaeX Ordered Locus Names:E2348C_3513
Expression Region:1-67
Sequence Info:full length protein
