Gene Bio Systems
Recombinant Escherichia coli NADH-quinone oxidoreductase subunit A(nuoA)
Recombinant Escherichia coli NADH-quinone oxidoreductase subunit A(nuoA)
SKU:CSB-CF539385ENP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
Uniprot NO.:B1IXQ4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1
Gene Names:Name:nuoA Ordered Locus Names:EcolC_1364
Expression Region:1-147
Sequence Info:full length protein
