Recombinant Escherichia coli K88 fimbrial protein AC (faeG)

SKU: P14190

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P14190

Gene Names: faeG

Alternative Name(s): K88 antigen;K88 pilin

Abbreviation: Recombinant E.coli faeG protein

Organism: Escherichia coli

Source: E.coli

Expression Region: 22-283aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: WMTGDFNGSVDIGGSITADDYRQKWEWKVGTGLNGFGNVLNDLTNGGTKLTITVTGNKPILLGRTKEAFATPVTGGVDGIPHIAFTDYEGASVVLRNPDGETNKKGLAYFVLPMKNAEGTKVGSVKVNASYAGVLGRGGVTSADGELLSLFADGLSSIFYGGLPRGSELSAGSAAAARTKLFGSLSRNDILGQIQRVNANITSLVDVAGSYRENMEYTDGTVVSAAYALGIANGQTIEATFNQAVTTSTQWSAPLNVAITYY

MW: 34.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: K88 major fimbrial subunit. Fimbriae (also called pili), are polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell. They enable bacteria to colonize the epithelium of specific host organs.

Reference:

Function: