Skip to product information
1 of 1

Gene Bio Systems

Recombinant Escherichia coli Inner membrane protein yhhQ(yhhQ)

Recombinant Escherichia coli Inner membrane protein yhhQ(yhhQ)

SKU:CSB-CF339845ENV

Regular price $2,195.20 CAD
Regular price Sale price $2,195.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P37619

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVFSQTQRYKALFWLSLFHLLVITSSNYLVQLPVSILGFHTTWGAFSFPFIFLATDLTV RIFGAPLARRIIFAVMIPALLISYVISSLFYMGSWQGFGALAHFNLFVARIATASFMAYA LGQILDVHVFNRLRQSRRWWLAPTASTLFGNVSDTLAFFFIAFWRSPDAFMAEHWMEIAL VDYCFKVLISIVFFLPMYGVLLNMLLKRLADKSEINALQAS

Protein Names:Recommended name: Inner membrane protein yhhQ

Gene Names:Name:yhhQ Ordered Locus Names:b3471, JW3436

Expression Region:1-221

Sequence Info:full length protein

View full details