Gene Bio Systems
Recombinant Escherichia coli Fumarate reductase subunit C(frdC)
Recombinant Escherichia coli Fumarate reductase subunit C(frdC)
SKU:CSB-CF543707ENT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli (strain K12 / DH10B)
Uniprot NO.:B1XDQ7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein
Gene Names:Name:frdC Ordered Locus Names:ECDH10B_4347
Expression Region:1-131
Sequence Info:full length protein
