Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)

Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)

CSB-EP333368ENL
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: bla

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Escherichia coli (strain K12)

Delivery time: 3-7 business days

Uniprot ID: P28585

AA Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Tag info: N-terminal 6xHis-tagged

Expression Region: 29-291aa

Protein length: Full Length

MW: 32.2 kDa

Alternative Name(s): Beta-lactamase MEN-1Cefotaximase 1

Relevance: Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.

Reference: Sequences of beta-lactamase genes encoding CTX-M-1 (MEN-1) and CTX-M-2 and relationship of their amino acid sequences with those of other beta-lactamases.Bauernfeind A., Stemplinger I., Jungwirth R., Casellas J.M.Antimicrob. Agents Chemother. 40:509-513(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share