Size: 20ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P25738
Gene Names: msyB
Organism: Escherichia coli (strain K12)
AA Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Expression Region: 1-124aa
Sequence Info: Full Length
Source: Baculovirus
Tag Info: C-terminal 6xHis-tagged
MW: 16.3 kDa
Alternative Name(s):
Relevance: Could participate in the normal pathway of protein export.
Reference: "Multicopy suppression: an approach to understanding intracellular functioning of the protein export system." Ueguchi C., Ito K. J. Bacteriol. 174:1454-1461(1992)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.