Gene Bio Systems
Recombinant Erwinia carotovora subsp. atroseptica Electron transport complex protein RnfG(rnfG)
Recombinant Erwinia carotovora subsp. atroseptica Electron transport complex protein RnfG(rnfG)
SKU:CSB-CF721799EAAB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum)
Uniprot NO.:Q6D4W0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMTTMRRHATTLALFAASTTAVTAVVNMLTEPTISHQAMLQQKMLLDQVVPAELYNSDIQ KECYVVTNPALGSSAPHRVFIARQNGEPVAAALESTAPDGYSGAIRLLVGADFHGKVLGV RVTEHHETPGLGDKIEVRISDWITRFNGLMVQGEHDARWAVKKEGGMFDQFTGATITPRA VINSVKRSALYLQTLPPQINTLSACGENQ
Protein Names:Recommended name: Electron transport complex protein RnfG Alternative name(s): Nitrogen fixation protein RnfG
Gene Names:Name:rnfG Ordered Locus Names:ECA2280
Expression Region:1-209
Sequence Info:full length protein
