Skip to product information
1 of 1

Gene Bio Systems

Recombinant Equine herpesvirus 2 Uncharacterized gene 28 protein(28)

Recombinant Equine herpesvirus 2 Uncharacterized gene 28 protein(28)

SKU:CSB-CF734417EFP

Regular price $2,013.20 CAD
Regular price Sale price $2,013.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Equine herpesvirus 2 (strain 86/87) (EHV-2)

Uniprot NO.:Q66631

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTTSPTTISTTTAATTTTTTPGKGTDSPMVYIEAMLFSMLVLILLIIVCAGYVHVKNLYY RSRYGVTAIYQQVEAECRGVSLGRSVDEPPYQSIYMPD

Protein Names:Recommended name: Uncharacterized gene 28 protein

Gene Names:Name:28

Expression Region:1-98

Sequence Info:full length protein

View full details