Gene Bio Systems
Recombinant Equine herpesvirus 2 SUSHI domain-containing protein E3(E3)
Recombinant Equine herpesvirus 2 SUSHI domain-containing protein E3(E3)
SKU:CSB-CF737649EFP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Equine herpesvirus 2 (strain 86/87) (EHV-2)
Uniprot NO.:Q66608
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GTPTPSKSTLIYNSQNCTTYPSIENGQSSLYYNGSWFIRYEFNCSSGYELQGWPYTTCIF WPKNGTIWTNGPPSCVKLNITTTLMPTSTSTTPVTTGTFPDPQNTTHPTHHTVKPTRRPI NLLRFGYTPWAIITLVVIILLVVWIVNCCMGPMF
Protein Names:Recommended name: SUSHI domain-containing protein E3
Gene Names:Name:E3
Expression Region:21-174
Sequence Info:full length protein
