Gene Bio Systems
Recombinant Enterococcus faecalis ATP synthase subunit b(atpF)
Recombinant Enterococcus faecalis ATP synthase subunit b(atpF)
SKU:CSB-CF772562ELW
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterococcus faecalis (strain ATCC 700802 / V583)
Uniprot NO.:Q831A1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLLTTLVVGETAPSTTLGTMIVVSGAFLILMLLLKKYAWGAIVDILTQREEKIANDLDSA EQSRVAAAKMEKERQQQLLSSRSEAAEIIKNAKESGEQTRQKTLKETTAEVTRLREKART DISQEREEALSSVKNEVADLSLQIAAKILNKELTPDAHEALIDSYIESLGKANETR
Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b
Gene Names:Name:atpF Ordered Locus Names:EF_2612
Expression Region:1-176
Sequence Info:full length protein
