Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q06718
Gene Names: N/A
Organism: Enterobacteria phage T6 (Bacteriophage T6)
AA Sequence: MIQFVIPSYQRVGAVSALDMFPTDYEPHIVVREHEEKAYNDAYGSRAKIITIPDGVNGIAGTRKAITDMYAGQRIWMIDDDTTIRMSSMRKRDDRRCVDKVNQLTHEQFYELIQYVEDAMDCGYYHGHARLPIFKITSSWGNYRENSYGFTNTWYDLGKLTTEQIGYGKIDLCEDMYAFLNLINQGYPHLALFKYLVVSGKAQAPGGCSSIRSNSKHNRALEQINREFPEQARWKTSNIEKRKSLGEEDEPLKVLRMCVSRKEKSEAFHKFNAIHPIAVD
Expression Region: 1-280aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 36.3 kDa
Alternative Name(s):
Relevance: Transfers a gentiobiosyl-group on a hydroxymethylcytosine residue in DNA. Is involved in a DNA modification process to protects the phage genome against its own nucleases and the host restriction endonuclease system.
Reference: "Cloning and sequencing of the genes of beta-glucosyl-HMC-alpha-glucosyl-transferases of bacteriophages T2 and T6." Winkler M., Rueger W. Nucleic Acids Res. 21:1500-1500(1993)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.