Recombinant Enterobacteria phage PRD1  Protein P35(XXXV)

Recombinant Enterobacteria phage PRD1 Protein P35(XXXV)

CSB-CF659687EDO
Regular price
$1,458.00 CAD
Sale price
$1,458.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Enterobacteria phage PRD1 (Bacteriophage PRD1)

Uniprot NO.:Q3T4L9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMENDEWWKYLIFPLVATLGGIVNYSKRALAMKRFSKLEFAVEAVSAAFVGLMVTLGGAA MDLSPHWLGMAAGMSGWMGADFVKAVFSQFVQSKIAPINQPGPIDSDNDKPGRTFND

Protein Names:Recommended name: Protein P35 Alternative name(s): Holin

Gene Names:Name:XXXV

Expression Region:1-117

Sequence Info:full length protein

Your list is ready to share