Gene Bio Systems
Recombinant Enterobacteria phage P22 Superinfection exclusion protein A(sieA)
Recombinant Enterobacteria phage P22 Superinfection exclusion protein A(sieA)
SKU:CSB-CF657115EDG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacteria phage P22 (Bacteriophage P22)
Uniprot NO.:Q38674
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSDSMSYAVLVAATLFLGIGLQIAWLFFSNFIKRKRLESRISEVSIAIGKNAKNPENEAY VLNYLKEKFSPERFENRITDALGLIISVIHIPLSLLITVWYFAMIAGRIFGFMNIEPVVL WVPMILQLLLSIAIFIFSVFIKIVFGRYPGEANGFNKEFIKTIK
Protein Names:Recommended name: Superinfection exclusion protein A
Gene Names:Name:sieA
Expression Region:1-164
Sequence Info:full length protein
