Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterobacteria phage lambda Holin(S)

Recombinant Enterobacteria phage lambda Holin(S)

SKU:CSB-CF361129ECW

Regular price $2,027.20 CAD
Regular price Sale price $2,027.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Enterobacteria phage lambda (Bacteriophage lambda)

Uniprot NO.:P03705

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTVIDATMCAIIAWFIRD LLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDGRNQ

Protein Names:Recommended name: Holin Alternative name(s): gpS protein Including the following 2 domains: Lysis protein S Lysis inhibitor

Gene Names:Name:S

Expression Region:1-107

Sequence Info:full length protein

View full details