
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P09386
Gene Names: stxB2
Organism: Enterobacteria phage 933W (Bacteriophage 933W)
AA Sequence: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Expression Region: 20-89aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 23.8 kDa
Alternative Name(s): Verocytotoxin 2 subunit B ;Verotoxin 2 subunit B
Relevance: The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
Reference: Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.Fraser M.E., Cherney M.M., Marcato P., Mulvey G.L., Armstrong G.D., James M.N.Acta Crystallogr. F 62:627-630(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.