Gene Bio Systems
Recombinant Enterobacter sp. UPF0299 membrane protein Ent638_2744 (Ent638_2744)
Recombinant Enterobacter sp. UPF0299 membrane protein Ent638_2744 (Ent638_2744)
SKU:CSB-CF394699EIZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacter sp. (strain 638)
Uniprot NO.:A4WCH9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIKALNTVWQYLRAFILIYACLYAGIFIASLLPITIPGSIIGMLIMFLLLALQILPAKWV NPGCFVLIRYMALLFVPIGVGVMQYYDVLKAQFGPIVVSCAISTLVVFLVVSWSSHLVHG ERKVVGQKGNQK
Protein Names:Recommended name: UPF0299 membrane protein Ent638_2744
Gene Names:Ordered Locus Names:Ent638_2744
Expression Region:1-132
Sequence Info:full length protein
