Skip to product information
1 of 1

Gene Bio Systems

Recombinant Enterobacter sp. UPF0059 membrane protein Ent638_2390 (Ent638_2390)

Recombinant Enterobacter sp. UPF0059 membrane protein Ent638_2390 (Ent638_2390)

SKU:CSB-CF396352EIZ

Regular price $2,146.20 CAD
Regular price Sale price $2,146.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Enterobacter sp. (strain 638)

Uniprot NO.:A4WBH9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20ā„ƒ, for extended storage, conserve at -20ā„ƒ or -80ā„ƒ.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4ā„ƒ for up to one week.

AA Sequence:MNISATILLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAIETLTPLIGWSLGML ASQFILEWNHWIAFTLLVFLGGRMVIEGFRNTPDEDDAPQYRHGFWILVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTIGMMVGRFIGPLLGKRAEILGGIVLIGIGGQ ILWSHFAG

Protein Names:Recommended name: UPF0059 membrane protein Ent638_2390

Gene Names:Ordered Locus Names:Ent638_2390

Expression Region:1-188

Sequence Info:full length protein

View full details