Gene Bio Systems
Recombinant Enterobacter sp. Protein CrcB homolog(crcB)
Recombinant Enterobacter sp. Protein CrcB homolog(crcB)
SKU:CSB-CF393984EIZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacter sp. (strain 638)
Uniprot NO.:A4W811
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLQLLLAVFIGGGTGSVARWFLSMRFNPMHQAIPLGTLTANLIGAFIIGVGLAWFNRMTH IDPMWKLLITTGFCGGLTTFSTFSAEVVFLLQDGRINWALANIAVNMLGSFAMTALAFWL FSAASAH
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:Ent638_1160
Expression Region:1-127
Sequence Info:full length protein
