Gene Bio Systems
Recombinant Drosophila pseudoobscura pseudoobscura UPF0389 protein GA21628(GA21628)
Recombinant Drosophila pseudoobscura pseudoobscura UPF0389 protein GA21628(GA21628)
SKU:CSB-CF645869DME
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Drosophila pseudoobscura pseudoobscura (Fruit fly)
Uniprot NO.:Q29DG0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFNKSALIGSLLRRSFGTTNPLRQAIKNHQPNEMEKRFLVWSGKYKSQAEVPAFVSQDEM ERVRNKMRIRLANIMIALTVIGCGIMVYSGKQAAKRGESVSKMNLEWHKQFNELKPEGGA AAPASTK
Protein Names:Recommended name: UPF0389 protein GA21628
Gene Names:ORF Names:GA21628
Expression Region:1-127
Sequence Info:full length protein
