Skip to product information
1 of 1

Gene Bio Systems

Recombinant Drosophila melanogaster UPF0640 protein CG32736(CG32736)

Recombinant Drosophila melanogaster UPF0640 protein CG32736(CG32736)

SKU:CSB-CF896189DLU

Regular price $1,985.20 CAD
Regular price Sale price $1,985.20 CAD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila melanogaster (Fruit fly)

Uniprot NO.:Q9W3T5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETNFYRTFKRRQA KNYVEEQQHLQARAANNTN

Protein Names:Recommended name: UPF0640 protein CG32736

Gene Names:ORF Names:CG32736

Expression Region:1-79

Sequence Info:full length protein

View full details